missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CYP4X1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | CYP4X1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CYP4X1 Polyclonal specifically detects CYP4X1 in Human samples. It is validated for Western Blot.Specifications
| CYP4X1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| CYPIVX1, cytochrome P450 4X1, cytochrome P450, family 4, subfamily X, polypeptide 1, EC 1.14.14.1, MGC40051 | |
| CYP4X1 | |
| IgG | |
| 59 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8N118 | |
| 260293 | |
| Synthetic peptides corresponding to CYP4X1(cytochrome P450, family 4, subfamily X, polypeptide 1) The peptide sequence was selected from the middle region of CYP4X1. Peptide sequence LDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNP. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title