missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CYP4X1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92388-0.02ml
This item is not returnable.
View return policy
Description
CYP4X1 Polyclonal antibody specifically detects CYP4X1 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| CYP4X1 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| CYPIVX1, cytochrome P450 4X1, cytochrome P450, family 4, subfamily X, polypeptide 1, EC 1.14.14.1, MGC40051 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 190-290 of human CYP4X1 (NP_828847.1). DIIMKCAFSKETNCQTNSTHDPYAKAIFELSKIIFHRLYSLLYHSDIIFKLSPQGYRFQKLSRVLNQYTDTIIQERKKSLQAGVKQDNTPKRKYQDFLDIV | |
| 0.02 mL | |
| Cancer, Cardiovascular Biology, Endocrinology | |
| 260293 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction