missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CYP4F2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
£231.00 - £470.00
Specifications
| Antigen | CYP4F2 |
|---|---|
| Concentration | 0.1mg/mL |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18463811
|
Novus Biologicals
NBP1-86461-25ul |
25 μL |
£231.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18262997
|
Novus Biologicals
NBP1-86461 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CYP4F2 Polyclonal specifically detects CYP4F2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CYP4F2 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 8529 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:RRNWFWGHQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPD | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| 0.1mg/mL | |
| Unconjugated | |
| RUO | |
| Human | |
| CPF2, CYPIVF2, Cytochrome P450 4F2, cytochrome P450, family 4, subfamily F, polypeptide 2, cytochrome P450, subfamily IVF, polypeptide 2, Cytochrome P450-LTB-omega, EC 1.14.13.30, leukotriene B4 omega-hydroxylase, Leukotriene-B(4) 20-monooxygenase 1, leukotriene-B(4) omega-hydroxylase 1, leukotriene-B4 20-monooxygenase | |
| CYP4F2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title