missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CYP39A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£145.00 - £417.00
Specifications
| Antigen | CYP39A1 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30230508
|
Novus Biologicals
NBP3-37895-100ul |
100 μL |
£417.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30226631
|
Novus Biologicals
NBP3-37895-20ul |
20 μL |
£145.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CYP39A1 Polyclonal antibody specifically detects CYP39A1 in Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| CYP39A1 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cardiovascular Biology, Cellular Signaling, metabolism | |
| PBS (pH 7.3), 50% glycerol | |
| 51302 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse, Rat | |
| Cytochrome P450 39A1, cytochrome P450, family 39, subfamily A, polypeptide 1, cytochrome P450, subfamily XXXIX (oxysterol 7 alpha-hydroxylase), polypeptide 1,24-hydroxycholesterol 7-alpha-hydroxylase, EC 1.14.13.99, hCYP39A1, oxysterol 7alpha-hydroxylase, Oxysterol 7-alpha-hydroxylase | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CYP39A1 (NP_057677.2).,, Sequence:, MELISPTVIIILGCLALFLLLQRKNLRRPPCIKGWIPWIGVGFEFGKAPLEFIEKARIKYGPIFTVFAMGNRMTFVTEEEGINVFLKSKKVDFELAVQNI | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title