missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CYP2U1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CYP2U1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CYP2U1 Polyclonal specifically detects CYP2U1 in Human samples. It is validated for Western Blot.Specifications
| CYP2U1 | |
| Polyclonal | |
| Rabbit | |
| NP_898898 | |
| 113612 | |
| The immunogen for this antibody is CYP2U1. Peptide sequence VNICPWLYYLPFGPFKELRQIEKDITSFLKKIIKDHQESLDRENPQDFID. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| cytochrome P450 2U1, cytochrome P450, family 2, subfamily U, polypeptide 1, EC 1.14.14.1, P450TEC | |
| CYP2U1 | |
| IgG | |
| 69 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title