missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
CYP2C70 Polyclonal specifically detects CYP2C70 in Mouse samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | CYP2C70 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of mouse CYP2C70 (NP_663474.2). Peptide sequence RGYHIPKGTSVMACLTSVLNDDKEFPNPEKFDPGHFLDEKGNFKKSDYFV |
| Purification Method | Affinity purified |
| Quantity | 100 μg |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?