missing translation for 'onlineSavingsMsg'
Learn More

CYP27A1 Antibody, Novus Biologicals™

Product Code. 18322368 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18322368 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18322368 Supplier Novus Biologicals Supplier No. H00001593B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Polyclonal Antibody

CYP27A1 Polyclonal antibody specifically detects CYP27A1 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen CYP27A1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot
Formulation PBS (pH 7.4)
Gene Accession No. NP_000775.1
Gene Alias 12-alpha-triol 27-hydroxylase, 7-alpha, cholestanetriol 26-monooxygenase, CP27,5-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 27-hydroxylase, CTX5-beta-cholestane-3-alpha, CYP275-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 26-hydroxylase, Cytochrome P450 27, cytochrome P450, family 27, subfamily A, polypeptide 1, cytochrome P450, subfamily XXVIIA (steroid 27-hydroxylase, cerebrotendinousxanthomatosis), polypeptide 1, Cytochrome P-450C27/25, EC 1.14.13.15, sterol 26-hydroxylase, mitochondrial, Sterol 27-hydroxylase, Vitamin D(3) 25-hydroxylase
Host Species Mouse
Immunogen CYP27A17A1 (NP_000775.1, 1 a.a. ~ 531 a.a) full-length human protein. MAALGCARLRWALRGAGRGLCPHGARAKAAIPAALPSDKATGAPGAGPGVRRRQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTFVRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAAGPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEALHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPKNTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC
Purification Method IgG purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 1593
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.