CYP24A1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10660-100UL

Product Code. 18343896

Description

CYP24A1 Polyclonal specifically detects CYP24A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CYP24A1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Alias: 25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial, CP241, CYP241,25-alphadihydroxyvitamin D3 24-hydroxylase, Cytochrome P450 24A1, cytochrome P450, family 24, subfamily A, polypeptide 1,24-OHase, cytochrome P450, subfamily XXIV (vitamin D 24-hydroxylase), Cytochrome P450-CC24, EC 1.14.13.n4, exo-mitochondrial protein, MGC126273, MGC126274, P450-CC24, vitamin D 24-hydroxylase, Vitamin D(3) 24-hydroxylase
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CYP24A1 (NP_000773). Peptide sequence LNTKVWQDHTLAWDTIFKSVKACIDNRLEKYSQQPSADFLCDIYHQNRLS
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1591
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.