CYP24A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57213

Product Code. 18265042

Description

CYP24A1 Polyclonal specifically detects CYP24A1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CYP24A1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: 25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial, CP241, CYP241,25-alphadihydroxyvitamin D3 24-hydroxylase, Cytochrome P450 24A1, cytochrome P450, family 24, subfamily A, polypeptide 1,24-OHase, cytochrome P450, subfamily XXIV (vitamin D 24-hydroxylase), Cytochrome P450-CC24, EC 1.14.13.n4, exo-mitochondrial protein, MGC126273, MGC126274, P450-CC24, vitamin D 24-hydroxylase, Vitamin D(3) 24-hydroxylase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1591
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CYP24A1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCDERGHVEDLYSELN
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only