missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CYFIP2 Antibody (4G6), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00026999-M01
This item is not returnable.
View return policy
Description
CYFIP2 Monoclonal antibody specifically detects CYFIP2 in Human samples. It is validated for Western Blot, ELISA
Specifications
| CYFIP2 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| cytoplasmic FMR1 interacting protein 2, cytoplasmic FMR1-interacting protein 2, KIAA1168, p53 inducible protein, PIR121p53-inducible protein 121 | |
| CYFIP2 (NP_055191, 733 a.a. ~ 820 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YGVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLEINRLTHRLLCKHMTLDSF | |
| 0.1 mg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, ELISA | |
| 4G6 | |
| Western Blot 1:500, ELISA | |
| NP_055191 | |
| Mouse | |
| IgG purified | |
| RUO | |
| 26999 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction