missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Cyclin T1 Polyclonal antibody specifically detects Cyclin T1 in Human samples. It is validated for Western Blot, Immunofluorescence
Specifications
Specifications
| Antigen | Cyclin T1 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04 to 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | CCNT, CCNT1, CCNTcyclin-T, CDK9-associated C-type protein, cyclin C-related protein, cyclin T1, cyclin T1b, Cyclin-T, cyclin-T1, CYCT1, HIVE1, human immunodeficiency virus type 1 (HIV-1) expression (elevated) 1, Human immunodeficiency virus-1 expression, subunit of positive elongation transcription factor b |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MEANVKSQYAYAAQNLLSHHDSHSSVILKMPIEGSENPERPFLEKADKTALKMRIPVAGGDKAASSKPEEIKMRIKVHAAADKHNSV |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?