Learn More
Invitrogen™ Cyclin T1 Polyclonal Antibody

Rabbit Polyclonal Antibody
Brand: Invitrogen™ PA578944
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat kidney tissue, mouse spleen tissue, JURKAT whole cell. IHC: mouse intestine tissue, rat intestine tissue, human intestinal cancer tissue. ICC/IF: A431 cell. Flow: U20S cell, U937 cell.
This gene encodes a member of the highly conserved cyclin C subfamily. The encoded protein tightly associates with cyclin-dependent kinase 9, and is a major subunit of positive transcription elongation factor b (p-TEFb). In humans, there are multiple forms of positive transcription elongation factor b, which may include one of several different cyclins along with cyclin-dependent kinase 9. The complex containing the encoded cyclin and cyclin-dependent kinase 9 acts as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and is both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner are also involved in triggering transcript elongation through phosphorylation of the carboxy-terminal domain of the largest RNA polymerase II subunit. Overexpression of this gene is implicated in tumor growth. Alternative splicing results in multiple transcript variants.
Specifications
| Cyclin T1 | |
| Polyclonal | |
| Unconjugated | |
| Ccnt1 | |
| 2810478G24Rik; AI115585; CCNT; CCNT1; CDK9-associated C-type protein; cyclin C-related protein; cyclin T1; cyclin T1b; cyclin-T; cyclin-T1; CycT1; HIVE1; human immunodeficiency virus type 1 (HIV-1) expression (elevated) 1 | |
| Rabbit | |
| Antigen affinity chromatography | |
| RUO | |
| 12455, 315291, 904 | |
| -20°C | |
| Lyophilized |
| Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry | |
| 500 μg/mL | |
| PBS with 5mg BSA and 0.05mg sodium azide | |
| O60563, Q9QWV9 | |
| Ccnt1 | |
| A synthetic peptide corresponding to a sequence in the middle region of human Cyclin T1 (375-410aa QKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENM). | |
| 100 μg | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.