missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cyclin J Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Cyclin J |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Cyclin J Polyclonal specifically detects Cyclin J in Human samples. It is validated for Western Blot.Specifications
| Cyclin J | |
| Polyclonal | |
| Rabbit | |
| Q5T5M9 | |
| 54619 | |
| Synthetic peptides corresponding to CCNJ(cyclin J) Antibody(against the N terminal of CCNJ. Peptide sequence FMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| bA690P14.1, cyclin J, cyclin-J, FLJ10895 | |
| CCNJ | |
| IgG | |
| 42 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title