missing translation for 'onlineSavingsMsg'
Learn More

Cyclin D2 Antibody, Novus Biologicals™

Product Code. 18394488 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18394488 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18394488 Supplier Novus Biologicals Supplier No. H00000894D01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Cyclin D2 Polyclonal antibody specifically detects Cyclin D2 in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence, Proximity Ligation Assay
TRUSTED_SUSTAINABILITY

Specifications

Antigen Cyclin D2
Applications Western Blot, Immunocytochemistry, Proximity Ligation Assay
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. NP_001750.1
Gene Alias cyclin D2, G1/S-specific cyclin D2, G1/S-specific cyclin-D2, KIAK0002, MGC102758
Host Species Rabbit
Immunogen CCND2 (NP_001750.1, 1 a.a. - 289 a.a.) full-length human protein. MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cell Cycle and Replication, Core ESC Like Genes, Ovarian Carcinoma Cell Markers, Stem Cell Markers, Wnt Signaling Pathway
Primary or Secondary Primary
Gene ID (Entrez) 894
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.