missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CYB5R3 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33219-20ul
This item is not returnable.
View return policy
Description
CYB5R3 Monoclonal antibody specifically detects CYB5R3 in Human,Rat samples. It is validated for ELISA,Western Blot
Specifications
| CYB5R3 | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| B5RNADH-cytochrome b5 reductase 3, Cytochrome b5 reductase, cytochrome b5 reductase 3, DIA1NADH-cytochrome b5 reductase 3 membrane-bound form, diaphorase (NADH) (cytochrome b-5 reductase), Diaphorase-1, EC 1.6.2.2, NADH-cytochrome b5 reductase 3 soluble form | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CYB5R3 (P00387).,, Sequence:, MGAQLSTLGHMVLFPVWFLYSLLMKLFQRSTPAITLESPDIKYPLRLIDREIISHDTRRFRFALPSPQHILGLPVGQHIYLSARIDGNLVVRPYTPISSD | |
| 20 μL | |
| Cancer, Lipid and Metabolism | |
| 1727 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction