missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
CYB5R3 Monoclonal antibody specifically detects CYB5R3 in Human samples. It is validated for ELISA, ELISA
Specifications
Specifications
| Antigen | CYB5R3 |
| Applications | ELISA, Sandwich ELISA |
| Classification | Monoclonal |
| Clone | 2A9 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | AAH04821 |
| Gene Alias | B5RNADH-cytochrome b5 reductase 3, Cytochrome b5 reductase, cytochrome b5 reductase 3, DIA1NADH-cytochrome b5 reductase 3 membrane-bound form, diaphorase (NADH) (cytochrome b-5 reductase), Diaphorase-1, EC 1.6.2.2, NADH-cytochrome b5 reductase 3 soluble form |
| Host Species | Mouse |
| Immunogen | CYB5R3 (AAH04821.1, 157 a.a. ~ 252 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGF |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?