missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CYB561 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CYB561 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CYB561 Polyclonal specifically detects CYB561 in Human samples. It is validated for Western Blot.Specifications
| CYB561 | |
| Polyclonal | |
| Rabbit | |
| P49447 | |
| 1534 | |
| Synthetic peptides corresponding to CYB561(cytochrome b-561) The peptide sequence was selected from the middle region of CYB561. Peptide sequence NVLGLLLACFGGAVLYILTRADWKRPSQAEEQALSMDFKTLTEGDSPGSQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| cytochrome b561, cytochrome b-561FRRS2, ferric-chelate reductase 2 | |
| CYB561 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title