missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CXorf66 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CXorf66 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CXorf66 Polyclonal specifically detects CXorf66 in Human samples. It is validated for Western Blot.Specifications
| CXorf66 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 347487 | |
| Synthetic peptides corresponding to CXorf66(chromosome X open reading frame 66) The peptide sequence was selected from the middle region of CXorf66. Peptide sequence PLYSSHPQNEISPSKPFGPQELAKPPKHFNPKRSVSLGRAALLSNSELAE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| chromosome X open reading frame 66, hypothetical protein LOC347487 | |
| CXORF66 | |
| IgG | |
| 40 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title