missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CXorf40A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £418.00
Specifications
| Antigen | CXorf40A |
|---|---|
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18638765
|
Novus Biologicals
NBP2-46859-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18643396
|
Novus Biologicals
NBP2-46859 |
0.1 mL |
£418.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CXorf40A Polyclonal antibody specifically detects CXorf40A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| CXorf40A | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| Q8TE69 | |
| 91966 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2), 40% Glycerol | |
| chromosome X open reading frame 40, chromosome X open reading frame 40A, CXorf40, EOLA1, EOLA1Endothelial-overexpressed lipopolysaccharide-associated factor 1, FLJ52212, protein CXorf40A | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: YAGFVLNGIKTVETRWRPLLSSQRNCTIAVHIAHRDWE | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title