missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CXCR5 Rabbit anti-Human, Mouse, Rat, Clone: 9Q10I2, Novus Biologicals™
Description
CXCR5 Monoclonal antibody specifically detects CXCR5 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunofluorescence
Specifications
Specifications
| Antigen | CXCR5 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Monoclonal |
| Clone | 9Q10I2 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | BLR1MDR-15, Burkitt lymphoma receptor 1, Burkitt lymphoma receptor 1, GTP binding protein (chemokine (C-X-C motif)receptor 5), Burkitt lymphoma receptor 1, GTP-binding protein, CD185, CD185 antigen, chemokine (C-X-C motif) receptor 5, C-X-C chemokine receptor type 5, CXC-R5, MDR15CXCR-5, MGC117347, Monocyte-derived receptor 15 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 273-372 of human CXCR5 (P32302). SPYHIVIFLDTLARLKAVDNTCKLNGSLPVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCTGPASLCQLFPSWRRSSLSESENATSLTTF |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?