missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CXCR5 Rabbit anti-Human, Mouse, Rat, Clone: 9Q10I2, Novus Biologicals™
Description
CXCR5 Monoclonal antibody specifically detects CXCR5 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunofluorescence
Spécification
Spécification
| Antigen | CXCR5 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Monoclonal |
| Clone | 9Q10I2 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | BLR1MDR-15, Burkitt lymphoma receptor 1, Burkitt lymphoma receptor 1, GTP binding protein (chemokine (C-X-C motif)receptor 5), Burkitt lymphoma receptor 1, GTP-binding protein, CD185, CD185 antigen, chemokine (C-X-C motif) receptor 5, C-X-C chemokine receptor type 5, CXC-R5, MDR15CXCR-5, MGC117347, Monocyte-derived receptor 15 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 273-372 of human CXCR5 (P32302). SPYHIVIFLDTLARLKAVDNTCKLNGSLPVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCTGPASLCQLFPSWRRSSLSESENATSLTTF |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?