missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
CXCR3 Monoclonal antibody specifically detects CXCR3 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence
Specifications
Specifications
| Antigen | CXCR3 |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence |
| Classification | Monoclonal |
| Clone | 3B7Y7 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | CD183, CD183 antigen, chemokine (C-X-C motif) receptor 3, chemokine (C-X-C) receptor 3, CKR-L2IP-10 receptor, CMKAR3, C-X-C chemokine receptor type 3, CXC-R3, CXCR-3, G protein-coupled receptor 9CD182, GPR9Mig-R, Interferon-inducible protein 10 receptor, IP10 receptor, IP10-R, Mig receptor, MigR |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CXCR3 (P49682). ATHCQYNFPQVGRTALRVLQLVAGFLLPLLVMAYCYAHILAVLLVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAK |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?