missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CXCL8/IL-8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
£229.00 - £460.00
Specifications
| Antigen | CXCL8/IL-8 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18456371
|
Novus Biologicals
NBP2-33819-25ul |
25 μL |
£229.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18727233
|
Novus Biologicals
NBP2-33819 |
£460.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Beschreibung
CXCL8/IL-8 Polyclonal specifically detects CXCL8/IL-8 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Spezifikation
| CXCL8/IL-8 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse | |
| P10145 | |
| 3576 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKF | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 | |
| Polyclonal | |
| Rabbit | |
| Angiogenesis, Cancer, Chemokines and Cytokines, Cytokine Research, Immunology, Innate Immunity, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 3-10C, AMCF-I, C-X-C motif chemokine 8, CXCL8SCYB8, Emoctakin, GCP-1TSG-1, interleukin 8, K60, LECT, MDNCFb-ENAP, member 8, MONAPGCP1, NAP-1NAP1, Neutrophil-activating protein 1, Protein 3-10C, T cell chemotactic factor, T-cell chemotactic factor | |
| IL8 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts