missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CXCL7/NAP-2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
£292.00 - £410.00
Specifications
| Antigen | CXCL7/NAP-2 |
|---|---|
| Concentration | 0.2mg/mL |
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18401992
|
Novus Biologicals
NBP1-89921-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18288046
|
Novus Biologicals
NBP1-89921 |
0.1 mL |
£410.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CXCL7/NAP-2 Polyclonal specifically detects CXCL7/NAP-2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CXCL7/NAP-2 | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, mTOR Pathway | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 5473 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:GQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| 0.2mg/mL | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Beta-TG, connective tissue-activating peptide III, CTAP3CTAP-III, CTAPIII, CXC chemokine ligand 7, C-X-C motif chemokine 7, CXCL7b-TG1, LA-PF4, LDGFTC1, Leukocyte-derived growth factor, low-affinity platelet factor IV, Macrophage-derived growth factor, MDGFTC2, NAP-2, NAP-2-L1, neutrophil-activating peptide 2, neutrophil-activating peptide-2, PBPTHBGB, platelet basic protein, pro-platelet basic protein (chemokine (C-X-C motif) ligand 7), SCAR10, SCYB7beta-thromboglobulin, small inducible cytokine B7, small inducible cytokine subfamily B, member 7, Small-inducible cytokine B7, TGB, TGB1B-TG1, THBGB1, thrombocidin 1, thrombocidin 2, thromboglobulin, beta-1 | |
| PPBP | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title