missing translation for 'onlineSavingsMsg'
Learn More

CXCL12/SDF-1 Antibody (1E5), Novus Biologicals™

Product Code. 18362059 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18362059 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18362059 Supplier Novus Biologicals Supplier No. H00006387M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

CXCL12/SDF-1 Monoclonal antibody specifically detects CXCL12/SDF-1 in Human samples. It is validated for ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen CXCL12/SDF-1
Applications ELISA, Sandwich ELISA
Classification Monoclonal
Clone 1E5
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. AAH39893
Gene Alias chemokine (C-X-C motif) ligand 12, C-X-C motif chemokine 12, hIRH, hSDF-1, Intercrine reduced in hepatomas, IRH, PBSFSDF-1a, Pre-B cell growth-stimulating factor, SCYB12, SDF-1, SDF1A, SDF1B, SDF1SDF-1b, stromal cell-derived factor 1, TLSF, TLSF-a, TLSF-b, TPAR1
Host Species Mouse
Immunogen CXCL12 (AAH39893.1, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Growth and Development, Neuronal Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 6387
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.