missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
CXCL11/I-TAC Monoclonal antibody specifically detects CXCL11/I-TAC in Human samples. It is validated for ELISA
Specifications
Specifications
| Antigen | CXCL11/I-TAC |
| Applications | ELISA |
| Classification | Monoclonal |
| Clone | 3D9 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | AAH05292 |
| Gene Alias | Beta-R1, b-R1, chemokine (C-X-C motif) ligand 11, H174IP9, Interferon gamma-inducible protein 9, Interferon-inducible T-cell alpha chemoattractant, IP-9member 11, ITAC, I-TACMGC102770, small inducible cytokine subfamily B (Cys-X-Cys), member 9B, Small-inducible cytokine B11 |
| Host Species | Mouse |
| Immunogen | CXCL11 (AAH05292, 1 a.a. ~ 94 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?