missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CX3CR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-69050-25ul
This item is not returnable.
View return policy
Description
CX3CR1 Polyclonal antibody specifically detects CX3CR1 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifications
| CX3CR1 | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Beta chemokine receptor-like 1, CCRL1, chemokine (C-C) receptor-like 1, chemokine (C-X3-C motif) receptor 1, chemokine (C-X3-C) receptor 1, CMKBRL1, CMK-BRL1, CMK-BRL-1, CMKDR1, CX3C chemokine receptor 1, Fractalkine receptor, G protein-coupled receptor 13, GPR13G-protein coupled receptor 13, GPRV28, V28C-X3-C CKR-1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: HLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDA | |
| 25 μL | |
| Chemokines and Cytokines, GPCR, Myeloid derived Suppressor Cell | |
| 1524 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction