missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CTP synthase Antibody, Novus Biologicals™

CTP synthase Antibody, Novus Biologicals™

Product Code. 30232521 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30232521 20 μL 20µL
30227268 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30232521 Supplier Novus Biologicals Supplier No. NBP33322920ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

CTP synthase Monoclonal antibody specifically detects CTP synthase in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen CTP synthase
Applications ELISA, Western Blot
Classification Monoclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL
Formulation PBS (pH 7.3), 50% glycerol, 0.05% BSA
Gene Alias CTP synthase, CTP synthase 1, CTP synthetase 1, cytidine 5-prime triphosphate synthetase, cytidine 5'-triphosphate synthetase, EC 6.3.4.2, UTP--ammonia ligase 1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CTP synthase (P17812).,, Sequence:, SVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCS
Purification Method Affinity purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 1503
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.