missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
CTP synthase Monoclonal antibody specifically detects CTP synthase in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | CTP synthase |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL |
| Formulation | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Gene Alias | CTP synthase, CTP synthase 1, CTP synthetase 1, cytidine 5-prime triphosphate synthetase, cytidine 5'-triphosphate synthetase, EC 6.3.4.2, UTP--ammonia ligase 1 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CTP synthase (P17812).,, Sequence:, SVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCS |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?