missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CTL5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-30814-25ul
This item is not returnable.
View return policy
Description
CTL5 Polyclonal specifically detects CTL5 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| CTL5 | |
| Polyclonal | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Q8NCS7 | |
| SLC44A5 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DDDCPTAIFPSKPFLQRCFPDFSTKNGTLTIGSKMMFQDGNGGTRSVVELGIAANGINKLLDAKSLGLKVFEDYAR | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Choline Transporter-Like Protein 5, SLC44A5, Solute Carrier Family 44 Member 5, Solute Carrier Family 44, Member 5 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 204962 | |
| Human | |
| IgG |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu