missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CTIF Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | CTIF |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CTIF Polyclonal specifically detects CTIF in Human samples. It is validated for Western Blot.Specifications
| CTIF | |
| Polyclonal | |
| Rabbit | |
| O43310 | |
| 9811 | |
| Synthetic peptides corresponding to KIAA0427(KIAA0427) The peptide sequence was selected from the N terminal of KIAA0427. Peptide sequence SSCSFSRGRAPPQQNGSKDNSLDMLGTDIWAANTFDSFSGATWDLQPEKL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CBP80/20-dependent translation initiation factor, KIAA0427Gm672 | |
| CTIF | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title