CTDSPL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-56941

Product Code. 18239431

Beschreibung

CTDSPL2 Polyclonal specifically detects CTDSPL2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Spezifikation

• Antigen: CTDSPL2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) smallphosphatase like 2, CTD small phosphatase-like protein 2, CTDSP-like 2, EC 3.1.3, EC 3.1.3.-, EC 3.1.3.16, FLJ10523, HSPC129
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51496
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CTDSPL2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RRKSQVNGEAGSYEMTNQHVKQNGKLEDNPSSGSPPRTTLLGTIFSPVFNFFSPANKNGTSGSDSPGQAVEAEEIVKQLDMEQVDEITTS
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only