missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CSN3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CSN3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CSN3 Polyclonal specifically detects CSN3 in Human samples. It is validated for Western Blot.Specifications
| CSN3 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| casein kappa, casein, kappa, CASK, CSN10kappa-casein, CSNK, KCA | |
| CSN3 | |
| IgG | |
| 20 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P07498 | |
| 1448 | |
| Synthetic peptides corresponding to CSN3 (casein kappa) The peptide sequence was selected from the N terminal of CSN3. Peptide sequence MKSFLLVVNALALTLPFLAVEVQNQKQPACHENDERPFYQKTAPYVPMYY. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title