missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CSH2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | CSH2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CSH2 Polyclonal specifically detects CSH2 in Human samples. It is validated for Western Blot.Specifications
| CSH2 | |
| Polyclonal | |
| Rabbit | |
| B1A4H9 | |
| 1443 | |
| Synthetic peptides corresponding to CSH2 (chorionic somatomammotropin hormone 2) The peptide sequence was selected from the middle region of CSH2. Peptide sequence LFDHAMLQAHRAHQLAIDTYQEFRLEDGSRRTGQILKQTYSKFDTNSHNH. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| chorionic somatomammotropin B, chorionic somatomammotropin hormone 2, CS-2, CSBChoriomammotropin, hCS-B, Lactogen, PL, Placental lactogen | |
| CSH2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title