missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CSAP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£385.00
Specifications
| Antigen | CSAP |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CSAP Polyclonal specifically detects CSAP in Human samples. It is validated for Western Blot.Specifications
| CSAP | |
| Polyclonal | |
| Rabbit | |
| C1orf96, centriole, cilia and spindle-associated protein, chromosome 1 open reading frame 96, RP4-803J11.3 | |
| CCSAP | |
| IgG | |
| 30 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 126731 | |
| Synthetic peptides corresponding to C1orf96 (chromosome 1 open reading frame 96) The peptide sequence was selected from the middle region of C1orf96. Peptide sequence ENKHPFALYGWGEKQTDTGSQKTHNVCASAPVHEIHESALRAKNRRQVEK. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title