missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CRMP4 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92073-0.02ml
This item is not returnable.
View return policy
Description
CRMP4 Polyclonal antibody specifically detects CRMP4 in Mouse, Rat samples. It is validated for Western Blot
Specifications
| CRMP4 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| Collapsin response mediator protein 4, CRMP-4, CRMP4collapsin response mediator protein 4 long, dihydropyrimidinase-like 3, DRP-3dihydropyrimidinase-related protein 3, DRP3ULIP1, ULIP-1, ULIPLCRMP, Unc-33-like phosphoprotein 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 440-520 of human CRMP4 (NP_001378.1). RGAPLVVICQGKIMLEDGNLHVTQGAGRFIPCSPFSDYVYKRIKARRKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSAR | |
| 0.02 mL | |
| Neuroscience | |
| 1809 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction