missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CRM1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35072-20ul
This item is not returnable.
View return policy
Description
CRM1 Polyclonal antibody specifically detects CRM1 in Human,Mouse samples. It is validated for ELISA,Western Blot
Specifications
| CRM1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA | |
| Chromosome region maintenance 1 protein homolog, DKFZp686B1823, emb, exp1, exportin 1 (CRM1 homolog, yeast), exportin 1 (CRM1, yeast, homolog), exportin-1, Exportin-1 (required for chromosome region maintenance), yeast, homolog | |
| A synthetic peptide corresponding to a sequence within amino acids 964-1064 of human CRM1 (NP_003391.1).,, Sequence:, PGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHE | |
| 20 μL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 7514 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction