missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Crk Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £488.00
Specifications
| Antigen | Crk |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18268471
|
Novus Biologicals
NBP2-57342 |
100 μL |
£488.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18684458
|
Novus Biologicals
NBP2-57342-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Crk Polyclonal specifically detects Crk in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| Crk | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Ovarian Carcinoma Cell Markers | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 1398 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPF | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| adapter molecule crk, avian sarcoma virus CT10 (v-crk) oncogene homolog, CRKII, p38, Proto-oncogene c-Crk, v-crk avian sarcoma virus CT10 oncogene homolog, v-crk sarcoma virus CT10 oncogene homolog (avian) | |
| CRK | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title