missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CRIF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-17823-25UL
This item is not returnable.
View return policy
Description
CRIF1 Polyclonal antibody specifically detects CRIF1 in Human samples. It is validated for Immunofluorescence
Specifications
| CRIF1 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| CKBBP2, CKII beta-associating protein, CR6 interacting factor 1, CRIF1p53-responsive gene 6 protein, growth arrest and DNA damage-inducible proteins-interacting protein 1, growth arrest and DNA-damage-inducible, gamma interacting protein 1, MGC4667, MGC4758, papillomavirus L2 interacting nuclear protein 1, Papillomavirus L2-interacting nuclear protein 1, Plinp1, PLINP-1CKII beta binding protein 2, PRG6CR6-interacting factor 1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: WPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPE | |
| 25 μg | |
| Cancer | |
| 90480 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction