CRIF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Bio-Techne NBP3-17823-100UL

Product Code. 18339871

Description

CRIF1 Polyclonal antibody specifically detects CRIF1 in Human samples. It is validated for Immunofluorescence

Specifications

• Antigen: CRIF1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
• Gene Alias: CKBBP2, CKII beta-associating protein, CR6 interacting factor 1, CRIF1p53-responsive gene 6 protein, growth arrest and DNA damage-inducible proteins-interacting protein 1, growth arrest and DNA-damage-inducible, gamma interacting protein 1, MGC4667, MGC4758, papillomavirus L2 interacting nuclear protein 1, Papillomavirus L2-interacting nuclear protein 1, Plinp1, PLINP-1CKII beta binding protein 2, PRG6CR6-interacting factor 1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: WPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPE
• Quantity: 100 μg
• Research Discipline: Cancer
• Gene ID (Entrez): 90480
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified