missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CRIF1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | CRIF1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18679515
|
Novus Biologicals
NBP2-39045-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18159937
|
Novus Biologicals
NBP2-39045 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CRIF1 Polyclonal specifically detects CRIF1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CRIF1 | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CKBBP2, CKII beta-associating protein, CR6 interacting factor 1, CRIF1p53-responsive gene 6 protein, growth arrest and DNA damage-inducible proteins-interacting protein 1, growth arrest and DNA-damage-inducible, gamma interacting protein 1, MGC4667, MGC4758, papillomavirus L2 interacting nuclear protein 1, Papillomavirus L2-interacting nuclear protein 1, Plinp1, PLINP-1CKII beta binding protein 2, PRG6CR6-interacting factor 1 | |
| GADD45GIP1 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q8TAE8 | |
| 90480 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ELEAEEREWYPSLATMQESLRVKQLAEEQKRRER | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title