missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CREM Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£145.00 - £417.00
Specifications
| Antigen | CREM |
|---|---|
| Dilution | Western Blot 1:100 - 1:500, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30228421
|
Novus Biologicals
NBP3-38171-20ul |
20 μL |
£145.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30229073
|
Novus Biologicals
NBP3-38171-100ul |
100 μL |
£417.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CREM Polyclonal antibody specifically detects CREM in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ImmunofluorescenceSpecifications
| CREM | |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Phospho Specific | |
| PBS (pH 7.3), 50% glycerol | |
| 1390 | |
| IgG | |
| Affinity purified |
| Western Blot 1:100 - 1:500, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| cAMP response element modulator, cAMP responsive element modulator, cAMP-responsive element modulator, hCREM 2alpha-b protein, hCREM 2beta-a protein, hCREM-2, ICER, Inducible cAMP early repressor, inducible cAMP early repressor ICER, MGC111110, MGC17881, MGC41893 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CREM (NP_853549.1).,, Sequence:, MSKCARKKYIKTNPRQMTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVP | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title