missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CREB3L3 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92157-0.02ml
This item is not returnable.
View return policy
Description
CREB3L3 Polyclonal antibody specifically detects CREB3L3 in Human, Rat samples. It is validated for Western Blot
Specifications
| CREB3L3 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000 | |
| cAMP responsive element binding protein 3-like 3, cAMP-responsive element-binding protein 3-like protein 3, CREB/ATF family transcription factor, CREB-H, CREBHMGC126557, cyclic AMP-responsive element-binding protein 3-like protein 3, MGC126553, Transcription factor CREB-H | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 371-460 of human CREB3L3 (NP_001258924.1). AADAVPGSEAPGPRPEADTTREESPGSPGADWGFQDTANLTNSTEELDNATLVLRNATEGLGQVALLDWVAPGPSTGSGRAGLEAAGDEL | |
| 0.02 mL | |
| Neurodegeneration, Neuroscience | |
| 84699 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction