missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18338138

CREB3 Antibody, Novus Biologicals™

Product Code. 18338138 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
missing translation for 'unitSize'
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18338138 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 missing translation for 'options'
This item is not returnable. View return policy
Product Code. 18338138 missing translation for 'mfr' Novus Biologicals missing translation for 'supplierNo' H00010488D01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

CREB3 Polyclonal antibody specifically detects CREB3 in Human samples. It is validated for Western Blot, Immunoprecipitation, Proximity Ligation Assay
TRUSTED_SUSTAINABILITY

Specifications

Antigen CREB3
Applications Western Blot, Immunoprecipitation, Proximity Ligation Assay
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation PBS (pH 7.4)
Gene Accession No. AAH09402.1
Gene Alias basic leucine zipper protein, cAMP responsive element binding protein 3, cAMP responsive element binding protein 3 (luman), cAMP-responsive element-binding protein 3, CREB-3, cyclic AMP response element (CRE)-binding protein/activating transcriptionfactor 1, cyclic AMP-responsive element-binding protein 3, LUMAN, LZIPMGC15333, MGC19782, Transcription factor LZIP-alpha
Host Species Rabbit
Immunogen CREB3 (AAH09402.1, 1 a.a. - 371 a.a.) full-length human protein. MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAIYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Neurodegeneration, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 10488
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.