missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Creatine kinase MT 1B Monoclonal antibody specifically detects Creatine kinase MT 1B in Human samples. It is validated for Western Blot, ELISA, ELISA
Specifications
Specifications
| Antigen | Creatine kinase MT 1B |
| Applications | Western Blot, ELISA, Sandwich ELISA |
| Classification | Monoclonal |
| Clone | 2C9 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_066270 |
| Gene Alias | Acidic-Type Mitochondrial Creatine Kinase, CKMT, CKMT1, CKMT1B, Creatine Kinase U-Type, Mitochondrial, Creatine Kinase, Mitochondrial 1 (Ubiquitous), Creatine Kinase, Mitochondrial 1B, EC 2.7.3.2, Mia-CK, Ubiquitous Mitochondrial Creatine Kinase, U-MtCK, UMTCK |
| Host Species | Mouse |
| Immunogen | CKMT1B (NP_066270, 327 a.a. ~ 417 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?