missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CPSF4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-57114
This item is not returnable.
View return policy
Description
CPSF4 Polyclonal specifically detects CPSF4 in Human samples. It is validated for Western Blot.
Specifications
| CPSF4 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| CPSF4 | |
| Synthetic peptides corresponding to CPSF4(cleavage and polyadenylation specific factor 4, 30kDa) The peptide sequence was selected from the C terminal of CPSF4. Peptide sequence SLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEK. | |
| 100 μL | |
| DNA replication Transcription Translation and Splicing | |
| 10898 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| 30kD, cleavage and polyadenylation specific factor 4, 30kD subunit, cleavage and polyadenylation specific factor 4, 30kDa, CPSF 30 kDa subunit, Neb-1, No arches homolog, no arches-like zinc finger protein, NS1 effector domain-binding protein 1 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| This product is specific to Subunit or Isoform: 4. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction