missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CPN1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CPN1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CPN1 Polyclonal specifically detects CPN1 in Human samples. It is validated for Western Blot.Specifications
| CPN1 | |
| Polyclonal | |
| Rabbit | |
| P15169 | |
| 1369 | |
| Synthetic peptides corresponding to CPN1(carboxypeptidase N, polypeptide 1) The peptide sequence was selected from the middle region of CPN1. Peptide sequence EWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVISVSGINHDVTSGD. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ACBP, Anaphylatoxin inactivator, Arginine carboxypeptidase, Carboxypeptidase N polypeptide 1, carboxypeptidase N polypeptide 1 50 kD, Carboxypeptidase N small subunit, carboxypeptidase N, polypeptide 1, carboxypeptidase N, polypeptide 1, 50kD, CPNcarboxypeptidase N catalytic chain, EC 3.4.17, EC 3.4.17.3, FLJ40792, kininase I, Kininase-1, Lysine carboxypeptidase, Plasma carboxypeptidase B, SCPNcarboxypeptidase N catalytic subunit, Serum carboxypeptidase N | |
| CPN1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title