CPI17 alpha Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58619-25ul

Product Code. 18675666

Description

CPI17 alpha Polyclonal specifically detects CPI17 alpha in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CPI17 alpha
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: 17 kDa PKC-potentiated inhibitory protein of PP1, CPI-1717-kDa PKC-potentiated inhibitory protein of PP1, CPI1717-KDa protein, PKC-potentiated inhibitory protein of PP1, PPP1INL, Protein kinase C-potentiated inhibitor protein of 17 kDa, protein phosphatase 1 regulatory subunit 14A, protein phosphatase 1, regulatory (inhibitor) subunit 14A
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PPP1R14A
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GLLKSCGKPVEDFIQELLAKLQGLHRQPGLRQPSPSHDGSLS
• Quantity: 25 μL
• Research Discipline: Protein Phosphatase
• Gene ID (Entrez): 94274
• Target Species: Human
• Isotype: IgG

For Research Use Only