missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18423569

COX6B2 Antibody, Novus Biologicals™

Product Code. 18423569 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
50µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18423569 0.05 mg 50µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18423569 Supplier Novus Biologicals Supplier No. H00125965B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Polyclonal Antibody

COX6B2 Polyclonal antibody specifically detects COX6B2 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen COX6B2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation PBS (pH 7.4)
Gene Accession No. NP_653214.2
Gene Alias Cancer/testis antigen 59, COX VIb-2, COXVIB2, CT59MGC119094, cytochrome c oxidase subunit 6B2, Cytochrome c oxidase subunit VIb isoform 2, cytochrome c oxidase subunit VIb polypeptide 2 (testis), cytochrome c oxidase subunit VIb, testes specific, cytochrome c oxidase subunit VIb, testes-specific, Cytochrome c oxidase subunit VIb, testis-specific isoform, FLJ32865, FLJ46422
Host Species Mouse
Immunogen COX6B2 (NP_653214.2, 1 a.a. - 88 a.a.) full-length human protein. MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPISWVESWNEQIKNGIFAGKI
Purification Method Protein A purified
Quantity 0.05 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 125965
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.