missing translation for 'onlineSavingsMsg'
Learn More
Learn More
COX6B1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92771-0.02ml
This item is not returnable.
View return policy
Description
COX6B1 Polyclonal antibody specifically detects COX6B1 in Human, Mouse samples. It is validated for Western Blot
Specifications
| COX6B1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000 | |
| COX VIb-1, COX6B, COXG, COXVIb1, cytochrome c oxidase subunit 6B1, cytochrome c oxidase subunit Vib, Cytochrome c oxidase subunit VIb isoform 1, cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous) | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human COX6B1 (NP_001854.1). MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI | |
| 0.02 mL | |
| Cancer, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction | |
| 1340 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction