COX6A1 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-92889-0.02ml

Product Code. 18692782

Description

COX6A1 Polyclonal antibody specifically detects COX6A1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: COX6A1
• Classification: Polyclonal
• Dilution: Western Blot 1:200-1:2000, Immunohistochemistry 1:20-1:200, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin
• Gene Alias: COX VIa-L, COX6A, COX6AL, Cytochrome c oxidase polypeptide VIa-liver, cytochrome c oxidase subunit 6A1, mitochondrial, cytochrome C oxidase subunit VIa homolog, cytochrome c oxidase subunit VIa polypeptide 1, Cytochrome c oxidase subunit VIA-liver, MGC104500
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-109 of human COX6A1 (NP_004364.2). SSGAHGEEGSARMWKTLTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE
• Quantity: 0.02 mL
• Research Discipline: Endocrinology, Neurodegeneration, Neuroscience
• Gene ID (Entrez): 1337
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified